Structure of PDB 4v8p Chain HU

Receptor sequence

>4v8pHU (length=203) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]

MKHNNQLPVAQLRKHQQFRIKTFFNQAAQKKARLHARRAQAAAVFPRPTE
KLQPVVRKQTQRYNKSTKLGRGFTLQELKAAGISAAFAQSIGIKVDHRRK
NRCQESLELNKKRLLAYVSKLVLFPRHQGKAKKGLVNDTADTSSAAQNAL
QTSVPLPSVSKREKAVSNIAELRKKKVYRIIRQEKTNQKWDGKRKAKAQA
AAE

3D structure

PDB

4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.

Chain

Resolution

3.52 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	HU	F24 N25 A28	F24 N25 A28
BS02	rna	HU	M1 K2 H3 N5 Q6 P8 L12 R13 K14 H15 Q26 A27 K30 R33 R37 V56 R57 K58 Q59 T60 R62 Y63 N64 K68 G70 R71 L75 K79 H97 R98 R99 K100 R102 C103 R126 K132 K161 Y178 R179 R182 Q183 K185 T186 K189 W190 G192 R194	M1 K2 H3 N5 Q6 P8 L12 R13 K14 H15 Q26 A27 K30 R33 R37 V56 R57 K58 Q59 T60 R62 Y63 N64 K68 G70 R71 L75 K79 H97 R98 R99 K100 R102 C103 R126 K132 K161 Y178 R179 R182 Q183 K185 T186 K189 W190 G192 R194

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum	4v8p
PubMed	22052974
UniProt	P0DJ58\|RL13_TETTS Large ribosomal subunit protein eL13 (Gene Name=RPL13)

[Back to BioLiP]