Structure of PDB 4v8p Chain HT

Receptor sequence

>4v8pHT (length=65) Species: 5911 (Tetrahymena thermophila)

AKSKNSTNKNQISKSHRNGIKKPKDHRHISTKGVNPRFLRNRRRAIKNDP
SIKKSKNLEKKVNKE

3D structure

• PDB: 4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
• Chain: HT
• Resolution: 3.52 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	HT	A2 K3 K5 N6 S7 T8 N9 K10 N11 Q12 I13 K15 H17 R18 N19 K23 H27 R28 H29 I30 S31 N36 P37 R38 F39 R41 N42 R43 R44 R45 A46 N49 D50 S52 K54 K55 S56 K57 N58 K61 K62	A1 K2 K4 N5 S6 T7 N8 K9 N10 Q11 I12 K14 H16 R17 N18 K22 H26 R27 H28 I29 S30 N35 P36 R37 F38 R40 N41 R42 R43 R44 A45 N48 D49 S51 K53 K54 S55 K56 N57 K60 K61

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
• PDBsum: 4v8p
• PubMed: 22052974
• UniProt: P0DJ21|RL29_TETTH Large ribosomal subunit protein eL29 (Gene Name=RPL29)