Structure of PDB 4v8p Chain HP

Receptor sequence
>4v8pHP (length=66) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]
PKEITDIKKFMKLWQNKKVVYVKTNKRITKFKLRGKKYLYTFKTADPKIA
KGIKDAIPATYSKIEI
3D structure
PDB4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
ChainHP
Resolution3.52 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna HP P2 K3 E4 K34 N36 K41 K43 R45 K47 Y49 L50 T52 K54 I77 P1 K2 E3 K23 N25 K30 K32 R34 K36 Y38 L39 T41 K43 I66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum4v8p
PubMed22052974
UniProtQ22SV3|RL38_TETTS Large ribosomal subunit protein eL38 (Gene Name=RPL38)

[Back to BioLiP]