Structure of PDB 8rdw Chain HK

Receptor sequence
>8rdwHK (length=100) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]
AKKSMINRELKREKEVAKYADKRTKLKETISDMNASDEVRMDAMLELQAL
PRNSSPVRLRNRCAITGRPHGYFRKFGLSRNMLRERVMQGDVPGVRKASW
3D structure
PDB8rdw A new family of bacterial ribosome hibernation factors
ChainHK
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna HK A2 K3 K4 S5 M6 N8 R9 K12 R13 M34 Q49 R53 V58 R59 R61 N62 T67 R69 H71 G72 Y73 R75 R81 N82 R85 K98 S100 W101 A1 K2 K3 S4 M5 N7 R8 K11 R12 M33 Q48 R52 V57 R58 R60 N61 T66 R68 H70 G71 Y72 R74 R80 N81 R84 K97 S99 W100
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rdw, PDBe:8rdw, PDBj:8rdw
PDBsum8rdw
PubMed38355796
UniProtA0A0M3V8P8

[Back to BioLiP]