Structure of PDB 4v8p Chain HK

Receptor sequence
>4v8pHK (length=52) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]
MEPTIAALAKKYNCEKKVCRDCYARLPPKATNCRKRKCGHSNSLRLKKKP
KE
3D structure
PDB4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
ChainHK
Resolution3.52 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna HK K93 R97 Y100 R102 P104 T108 N109 R111 K112 R113 K114 C115 G116 N119 R122 K124 K125 K16 R20 Y23 R25 P27 T31 N32 R34 K35 R36 K37 C38 G39 N42 R45 K47 K48
BS02 ZN HK C96 C99 C110 C19 C22 C33
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum4v8p
PubMed22052974
UniProtP0DJ25|RL40_TETTS Ubiquitin-ribosomal protein eL40 fusion protein (Gene Name=RPL40)

[Back to BioLiP]