Structure of PDB 4wzj Chain HHHH |
>4wzjHHHH (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] |
SIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYR DGRVAQLEQVYIRGSKIRFLILPDMLKNAPML |
|
PDB | 4wzj Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis. |
Chain | HHHH |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
HHHH |
N40 R64 G65 S66 |
N39 R63 G64 S65 |
|
|
|
|