Structure of PDB 8q3e Chain HHH

Receptor sequence
>8q3eHHH (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
3D structure
PDB8q3e Viral peptide conjugates for metal-warhead delivery to chromatin.
ChainHHH
Resolution2.174 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide HHH V41 Q44 L103 H106 E110 V14 Q17 L76 H79 E83
BS02 dna HHH R28 R30 K31 S33 Y37 R1 R3 K4 S6 Y10
BS03 dna HHH S29 Y39 S52 S53 R83 S84 T85 S2 Y12 S25 S26 R56 S57 T58
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8q3e, PDBe:8q3e, PDBj:8q3e
PDBsum8q3e
PubMed38495982
UniProtO60814|H2B1K_HUMAN Histone H2B type 1-K (Gene Name=H2BC12)

[Back to BioLiP]