Structure of PDB 7ap5 Chain HHH

Receptor sequence

>7ap5HHH (length=184) Species: 2283151 (Nostoc sp. WR13)

MLDAFSRAVVSADASTSTVSDIAALRAFVASGNRRLDAVNAIASNASCMV
SDAVAGMICENQGLIQAGGNCYPNRRMAACLRDAEIILRYVTYALLAGDA
SVLDDRCLNGLKETYAALGVPTTSTVRAVQIMKAQAAAHIQDTPSEARAG
AKLRKMGSPVVEDRCASLVAEASSYFDRVISALS

3D structure

• PDB: 7ap5 The crystal stacks of hexameric assemblies of phycoerythrin from cyanobacterium Nostoc sp. WR13 resemble rods of phycobilisome
• Chain: HHH
• Resolution: 2.131 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	HHH	N70 C71 R75 R76 A79 C80 R82 D83 I86 L118 V120 T125	N70 C71 R75 R76 A79 C80 R82 D83 I86 L118 V120 T125
BS02	PEB	HHH	N33 R34 L36 D37 I140 Q141 S158 P159 V161 C165	N33 R34 L36 D37 I140 Q141 S158 P159 V161 C165
BS03	PEB	HHH	C48 D52 A55 G56 C59 R127 A134 Q135 H139 P144 S145 R148 A149 K152	C48 D52 A55 G56 C59 R127 A134 Q135 H139 P144 S145 R148 A149 K152

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 20:47:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7ap5', asym_id = 'HHH', title = 'The crystal stacks of hexameric assemblies of ph...um Nostoc sp. WR13 resemble rods of phycobilisome'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7ap5', asym_id='HHH', title='The crystal stacks of hexameric assemblies of ph...um Nostoc sp. WR13 resemble rods of phycobilisome')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '7ap5', asym_id = 'HHH'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='7ap5', asym_id='HHH')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>