Structure of PDB 7y4l Chain HF

Receptor sequence

>7y4lHF (length=177) Species: 35688 (Porphyridium purpureum)

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

• PDB: 7y4l In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.
• Chain: HF
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	HF	I67 N76 M79	I67 N76 M79
BS02	PEB	HF	N35 L38 D39 I142 F153 A154 G156 C158	N35 L38 D39 I142 F153 A154 G156 C158
BS03	PEB	HF	C50 D54 G58 C61 R129 A136 Q137 T147 E148	C50 D54 G58 C61 R129 A136 Q137 T147 E148
BS04	PEB	HF	N72 C73 R77 R78 A81 C82 R84 D85 I88	N72 C73 R77 R78 A81 C82 R84 D85 I88

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030089 phycobilisome

External links

• PDB: RCSB:7y4l, PDBe:7y4l, PDBj:7y4l
• PDBsum: 7y4l
• PubMed: 36922595
• UniProt: P11393|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)