Structure of PDB 4v8p Chain HF

Receptor sequence
>4v8pHF (length=125) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]
VFNKFVQVGRVVYINYGADKGKLAVIVNIINQNRILIDGEHIVRQVIPIR
RVHLTKFQIDNVELNQRTVLLKKKIAKFDLTKKYAETSFAKKQAIKTKRA
NLGDFDRFRVMVLKKKLARTSAKSK
3D structure
PDB4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
ChainHF
Resolution3.52 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna HF V2 N4 N16 Y17 N29 R35 R52 H54 E64 L65 N66 Q67 R68 V70 F90 K97 F109 M112 V113 K115 K116 R120 V1 N3 N15 Y16 N28 R34 R51 H53 E63 L64 N65 Q66 R67 V69 F89 K96 F108 M111 V112 K114 K115 R119
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum4v8p
PubMed22052974
UniProtQ24C27|RL14_TETTS Large ribosomal subunit protein eL14 (Gene Name=RPL14)

[Back to BioLiP]