Structure of PDB 8ipa Chain HB

Receptor sequence

>8ipaHB (length=205) Species: 4565 (Triticum aestivum) [Search protein sequence]

GRRPARCYRQIKNKPYPKSRYCRGVPDPKIRIYDVGMKKKGVDEFPSCVH
LVSWEKENVSSEALEAARIACNKYMTKNAGKDAFHLRVRVHPYHVLRINK
QTGMRGAFGKPLGTCARVDIGQVLLSVRCKESNAVHADEALRRAKFKFPG
RQKIIRSRKWGFTKFNRADYIKYKSEGRIVPDGVNAKLLGVHGPIAKRAP
GQAIL

3D structure

PDB

8ipa Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	HB	R3 R4 A6 R7 C8 K13 N14 K15 Y17 Y22 R24 K39 K40 E63 A64 A67 R90 H92 Y94 R98 N100 M115 R116 A118 F119 Q133 R154 F157 K158 P160 R162 D193 K198	R2 R3 A5 R6 C7 K12 N13 K14 Y16 Y21 R23 K38 K39 E62 A63 A66 R89 H91 Y93 R97 N99 M104 R105 A107 F108 Q122 R143 F146 K147 P149 R151 D182 K187
BS02	rna	HB	E56 G201 V202 H203 G204 P205 I206 R209 I215	E55 G190 V191 H192 G193 P194 I195 R198 I204

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ipa, PDBe:8ipa, PDBj:8ipa
PDBsum	8ipa
PubMed	38267667
UniProt	A0A3B6HUM3

[Back to BioLiP]