Structure of PDB 4v8p Chain HB

Receptor sequence

>4v8pHB (length=51) Species: 5911 (Tetrahymena thermophila)

GANKTLNMKKRFGRKIKQNRPLPNWYRYKSDTNIRYNSKRRNWRRTKLKI
Y

3D structure

• PDB: 4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
• Chain: HB
• Resolution: 3.52 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	HB	T6 L7 K11 R12 R15 K18 Q19 R21 L23 W26 Y27 Y29 K30 S31 K40 Y52	T5 L6 K10 R11 R14 K17 Q18 R20 L22 W25 Y26 Y28 K29 S30 K39 Y51
BS02	rna	HB	G2 A3 N4 K5 L7 K10 F13 P22 I35 Y37 N38 S39 R41 R42 W44 R45 K48 L49 K50	G1 A2 N3 K4 L6 K9 F12 P21 I34 Y36 N37 S38 R40 R41 W43 R44 K47 L48 K49

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
• PDBsum: 4v8p
• PubMed: 22052974
• UniProt: P0DJ61|RL39_TETTS Large ribosomal subunit protein eL39 (Gene Name=RPL39)