Structure of PDB 8ipb Chain HA

Receptor sequence

>8ipbHA (length=203) Species: 4565 (Triticum aestivum)

GAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRL
GFKAKQGYVVYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSV
AEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILVDVAHSAVRNDPRINWL
CKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATWKRNQTVSLR
RYR

3D structure

• PDB: 8ipb Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.
• Chain: HA
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	HA	G2 Y4 K5 R12 R13 K14 Q15 R24 R31 A35 T40 R41 R44 R47 R49 R50 L51 K54 A55 K56 R67 R68 G69 G70 R71 K72 P74 P76 K77 I79 Y81 G82 K83 P84 K85 H86 Q87 I89 T90 Q91 K93 F94 Q95 R96 N97 K98 R105 R108 G112 W120 S125 T126 K128 A138 S140 A141 N144 R147 W150 P154 V155 H156 K157 H158 R159 R162 L164 S166 K169 K170 F171 R172 R175 K177 G178 H179 R180 H181 H182 K183 R185 P186 S187 R188 R189 W192 K193 R194 N195 S199 R204	G1 Y3 K4 R11 R12 K13 Q14 R23 R30 A34 T39 R40 R43 R46 R48 R49 L50 K53 A54 K55 R66 R67 G68 G69 R70 K71 P73 P75 K76 I78 Y80 G81 K82 P83 K84 H85 Q86 I88 T89 Q90 K92 F93 Q94 R95 N96 K97 R104 R107 G111 W119 S124 T125 K127 A137 S139 A140 N143 R146 W149 P153 V154 H155 K156 H157 R158 R161 L163 S165 K168 K169 F170 R171 R174 K176 G177 H178 R179 H180 H181 K182 R184 P185 S186 R187 R188 W191 K192 R193 N194 S198 R203
BS02	rna	HA	R38 Q57 V60 Y62 D136 H139	R37 Q56 V59 Y61 D135 H138

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ipb, PDBe:8ipb, PDBj:8ipb
• PDBsum: 8ipb
• PubMed: 38267667
• UniProt: W5FEX7