Structure of PDB 6kgx Chain H5

Receptor sequence
>6kgxH5 (length=146) Species: 35688 (Porphyridium purpureum) [Search protein sequence]
ADGNKRLDAVNSIVSNASCMVSDAVSGMICENPGLISPGGNCYTNRRMAA
CLRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSSIRAV
SIMKAQAVAFITNTATERKMSFAAGDCTSLASEVASYFDRVGAAIS
3D structure
PDB6kgx Structural basis of energy transfer in Porphyridium purpureum phycobilisome.
ChainH5
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PEB H5 N72 C73 R78 A81 C82 R84 D85 L113 L120 V122 S127 N41 C42 R47 A50 C51 R53 D54 L82 L89 V91 S96
BS02 PEB H5 N35 K36 L38 D39 I142 F153 A154 G156 C158 N4 K5 L7 D8 I111 F122 A123 G125 C127
BS03 PEB H5 C50 C61 I133 Q137 F141 A146 T147 E148 C19 C30 I102 Q106 F110 A115 T116 E117
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030089 phycobilisome

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kgx, PDBe:6kgx, PDBj:6kgx
PDBsum6kgx
PubMed32076272
UniProtP11393|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]