Structure of PDB 7a01 Chain H2

Receptor sequence

>7a01H2 (length=153) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESN
AELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILT
EKE

3D structure

PDB

7a01 The Halastavi arva Virus Intergenic Region IRES Promotes Translation by the Simplest Possible Initiation Mechanism.

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H2	R3 Y4 L6 K16 S17 R18 S20 H25 F26 K27 R30 Q34 K37 K54 R62 Y63 N64 G65 G66 R69 A71 Q72 Q75 Q80 R82 W83 K86 H93 K96 N97 S100 N101 L104 Q118 V119 R127 T129 Y130 R131 A132 H133 G134 R135 I136 N137 P138 Y139 M140 S141	R2 Y3 L5 K15 S16 R17 S19 H24 F25 K26 R29 Q33 K36 K53 R61 Y62 N63 G64 G65 R68 A70 Q71 Q74 Q79 R81 W82 K85 H92 K95 N96 S99 N100 L103 Q117 V118 R126 T128 Y129 R130 A131 H132 G133 R134 I135 N136 P137 Y138 M139 S140
BS02	rna	H2	R3 R61 R62 N120 P123	R2 R60 R61 N119 P122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7a01, PDBe:7a01, PDBj:7a01
PDBsum	7a01
PubMed	33296660
UniProt	G1SCJ6\|RL17_RABIT Large ribosomal subunit protein uL22 (Gene Name=RPL17)

[Back to BioLiP]