Structure of PDB 6zvk Chain H2

Receptor sequence

>6zvkH2 (length=153) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESN
AELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILT
EKE

3D structure

PDB

6zvk The Halastavi arva Virus Intergenic Region IRES Promotes Translation by the Simplest Possible Initiation Mechanism.

Chain

Resolution

3.49 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H2	V2 L6 K16 R18 S20 L22 H25 F26 R30 Q34 K54 R62 Y63 G65 G66 G68 R69 A71 Q72 K74 W78 T79 Q80 R82 W83 K85 K86 K96 N97 S100 N101 Q118 V119 K121 R127 T129 Y130 R131 A132 H133 R135 I136 N137 P138 Y139 M140 S141	V1 L5 K15 R17 S19 L21 H24 F25 R29 Q33 K53 R61 Y62 G64 G65 G67 R68 A70 Q71 K73 W77 T78 Q79 R81 W82 K84 K85 K95 N96 S99 N100 Q117 V118 K120 R126 T128 Y129 R130 A131 H132 R134 I135 N136 P137 Y138 M139 S140
BS02	rna	H2	R3 S5 R61 R62 K121	R2 S4 R60 R61 K120

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6zvk, PDBe:6zvk, PDBj:6zvk
PDBsum	6zvk
PubMed	33296660
UniProt	G1SCJ6\|RL17_RABIT Large ribosomal subunit protein uL22 (Gene Name=RPL17)

[Back to BioLiP]