Structure of PDB 8bhf Chain H1

Receptor sequence
>8bhfH1 (length=99) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
QLLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVSLERS
KSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANTKESYELRYF
3D structure
PDB8bhf Modulation of GluA2-gamma 5 synaptic complex desensitization, polyamine block and antiepileptic perampanel inhibition by auxiliary subunit cornichon-2.
ChainH1
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H1 R46 K48 N50 S79 K80 R81 Y82 K84 Y85 K88 K89 K92 R97 R101 V103 A104 K107 Y110 R113 R30 K32 N34 S63 K64 R65 Y66 K68 Y69 K72 K73 K76 R81 R85 V87 A88 K91 Y94 R97
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 22:39:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8bhf', asym_id = 'H1', title = 'Modulation of GluA2-gamma 5 synaptic complex des...nel inhibition by auxiliary subunit cornichon-2. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8bhf', asym_id='H1', title='Modulation of GluA2-gamma 5 synaptic complex des...nel inhibition by auxiliary subunit cornichon-2. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8bhf', asym_id = 'H1'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8bhf', asym_id='H1')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>