Structure of PDB 7piw Chain H1

Receptor sequence
>7piwH1 (length=67) Species: 3046 (Dunaliella salina) [Search protein sequence]
EPGIVTPLGTLLRPLNSEAGKVLPGWGTTVLMAVAILLFAVFLLIILEIY
NSSLILDGVTNSWESLA
3D structure
PDB7piw Structure of Dunaliella Photosystem II reveals conformational flexibility of stacked and unstacked supercomplexes.
ChainH1
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA H1 F60 L61 I64 L65 Y68 F42 L43 I46 L47 Y50
BS02 CLA H1 F57 A58 F39 A40
BS03 CLA H1 T46 M50 T28 M32
BS04 CLA H1 L30 L33 N34 L12 L15 N16
BS05 CLA H1 T24 L26 G27 T6 L8 G9
BS06 RRX H1 A53 F57 F60 A35 F39 F42
BS07 CLA H1 L29 L30 L11 L12
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7piw, PDBe:7piw, PDBj:7piw
PDBsum7piw
PubMed36799903
UniProtD0FY02

[Back to BioLiP]