Structure of PDB 9gd3 Chain H |
>9gd3H (length=93) Species: 8355 (Xenopus laevis) [Search protein sequence] |
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA |
|
PDB | 9gd3 Resolution of transcription-induced hexasome-nucleosome complexes by Chd1 and FACT. |
Chain | H |
Resolution | 3.0 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
H |
T29 R83 S84 T85 |
T1 R55 S56 T57 |
|
|
|