Structure of PDB 9gd1 Chain H |
>9gd1H (length=91) Species: 8355 (Xenopus laevis) [Search protein sequence] |
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA |
|
PDB | 9gd1 Resolution of transcription-induced hexasome-nucleosome complexes by Chd1 and FACT. |
Chain | H |
Resolution | 4.0 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
H |
R83 S84 |
R53 S54 |
|
|
|