Structure of PDB 8y6u Chain H

Receptor sequence
>8y6uH (length=92) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MSKRLPPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGL
KLFRRRNRSLLLTEEGQSYFLDIKEIFSQLTEATRKLQARSA
3D structure
PDB8y6u NMR analysis of a loop-bulge structure of UUCGA pentaloop.
ChainH
Resolution3.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H F23 S38 H39 R58 F23 S38 H39 R58
BS02 dna H N9 V32 T33 A35 A36 H39 Q40 N57 N9 V32 T33 A35 A36 H39 Q40 N57
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0009411 response to UV
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y6u, PDBe:8y6u, PDBj:8y6u
PDBsum8y6u
PubMed38039839
UniProtP0A9F6|GCVA_ECOLI Glycine cleavage system transcriptional activator (Gene Name=gcvA)

[Back to BioLiP]