Structure of PDB 8wi8 Chain H

Receptor sequence

>8wi8H (length=182) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

KALPRLKQRYREEIREALQQEFNYANVMQIPGVVKVVVNMGVGDAARDAK
LINGAINDLALITGQKPEVRRARKSIAQFKLREGMPIGARVTLRGDRMWE
FLDRLISIALPRIRDFRGLSPKQFDGTGNYTFGLNEQSMFHEIDVDSIDR
PRGMDITVVTTATNDAEGRALLRALGFPFKEN

3D structure

• PDB: 8wi8 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
• Chain: H
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	K40 V42 N44 G46 V47 G48 R75 R78 K79 I81 Q83 F84 I92 R95 Q128 D130 N134 T136 G138 L139 N140 G158 D160	K35 V37 N39 G41 V42 G43 R70 R73 K74 I76 Q78 F79 I87 R90 Q123 D125 N129 T131 G133 L134 N135 G153 D155
BS02	rna	H	N31 M33 Q34 Q70 K71 E73 V74 R76 T97 R99	N26 M28 Q29 Q65 K66 E68 V69 R71 T92 R94

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8wi8, PDBe:8wi8, PDBj:8wi8
• PDBsum: 8wi8
• PubMed: 38245551
• UniProt: A0QSG1|RL5_MYCS2 Large ribosomal subunit protein uL5 (Gene Name=rplE)