Structure of PDB 8wi7 Chain H

Receptor sequence
>8wi7H (length=182) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
KALPRLKQRYREEIREALQQEFNYANVMQIPGVVKVVVNMGVGDAARDAK
LINGAINDLALITGQKPEVRRARKSIAQFKLREGMPIGARVTLRGDRMWE
FLDRLISIALPRIRDFRGLSPKQFDGTGNYTFGLNEQSMFHEIDVDSIDR
PRGMDITVVTTATNDAEGRALLRALGFPFKEN
3D structure
PDB8wi7 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
ChainH
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H N44 R75 R78 F84 I92 R95 Q128 D130 N134 T136 L139 G158 D160 N39 R70 R73 F79 I87 R90 Q123 D125 N129 T131 L134 G153 D155
BS02 rna H N31 M33 Q34 Q70 E73 V74 R76 T97 R99 N26 M28 Q29 Q65 E68 V69 R71 T92 R94
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wi7, PDBe:8wi7, PDBj:8wi7
PDBsum8wi7
PubMed38245551
UniProtA0QSG1|RL5_MYCS2 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]