Structure of PDB 8wh5 Chain H |
>8wh5H (length=92) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLAR YNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS |
|
PDB | 8wh5 Molecular basis of chromatin remodelling by DDM1 involved in plant DNA methylation. |
Chain | H |
Resolution | 3.58 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
H |
S81 P112 T113 |
S24 P55 T56 |
|
|
|
|