Structure of PDB 8v87 Chain H

Receptor sequence

>8v87H (length=189) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

MKYIQTEQQIEVPEGVTVSIKSRIVKVVGPRGTLTKNLKHIDVTFTKVNN
QLIKVAVHNGGRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN
VNIVEKDGAKFIEVRNFLGDKKIRNVPVRDGVTIEFSTNVKDEIVLSGNS
VEDVSQNAADLQQICRVRNKDIRKFLDGIYVSHKGFITE

3D structure

PDB

8v87 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.

Chain

Resolution

2.66 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	S19 I20 K21 S22 R23 K26 K39 H40 V43 T44 H58 R62 K63 A66 R69 T70 S73 N77 H96 F97 D120 K121 K122 E152 S155 Q163 K170 D171 R173 K174	S19 I20 K21 S22 R23 K26 K39 H40 V43 T44 H58 R62 K63 A66 R69 T70 S73 N77 H96 F97 D120 K121 K122 E152 S155 Q163 K170 D171 R173 K174

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8v87, PDBe:8v87, PDBj:8v87
PDBsum	8v87
PubMed	38632236
UniProt	P05738\|RL9A_YEAST Large ribosomal subunit protein uL6A (Gene Name=RPL9A)

[Back to BioLiP]