Structure of PDB 8ux1 Chain H

Receptor sequence
>8ux1H (length=97) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
KKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
3D structure
PDB8ux1 Cryo-EM structure of Ran bound to RCC1 and the nucleosome core particle
ChainH
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H R30 K31 S33 I36 Y37 R5 K6 S8 I11 Y12
BS02 dna H R28 K29 R30 Y39 G50 I51 S52 S53 R83 S84 T85 R3 K4 R5 Y14 G25 I26 S27 S28 R58 S59 T60
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0044877 protein-containing complex binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ux1, PDBe:8ux1, PDBj:8ux1
PDBsum8ux1
PubMed
UniProtP02283|H2B_DROME Histone H2B (Gene Name=His2B)

[Back to BioLiP]