Structure of PDB 8tq1 Chain H

Receptor sequence

>8tq1H (length=41) Species: 9913 (Bos taurus)

NKVKSCPSGEDCGIGCCYHGCSATDYGCWDGSSYAPYSYTY

3D structure

• PDB: 8tq1 Immunization of cows with HIV Envelope trimers generates broadly neutralizing antibodies to the V2-apex as well as the CD4 binding site from the ultra-long CDRH3 repertoire
• Chain: H
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MAN	H	S108 C109	S5 C6

External links

• PDB: RCSB:8tq1, PDBe:8tq1, PDBj:8tq1
• PDBsum: 8tq1