Structure of PDB 8t9h Chain H |
>8t9hH (length=91) Species: 8355 (Xenopus laevis) [Search protein sequence] |
ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYN KRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK |
|
PDB | 8t9h Catalytic and non-catalytic mechanisms of histone H4 lysine 20 methyltransferase SUV420H1 |
Chain | H |
Resolution | 3.37 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
H |
R87 S88 T89 |
R52 S53 T54 |
|
|
|
|