Structure of PDB 8t3w Chain H |
>8t3wH (length=94) Species: 8355 (Xenopus laevis) [Search protein sequence] |
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK |
|
PDB | 8t3w Cryo-EM structure of Bre1-nucleosome complex in state 2 |
Chain | H |
Resolution | 3.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
H |
S56 S87 T88 |
S25 S56 T57 |
|
|
|
|