Structure of PDB 8r2i Chain H

Receptor sequence
>8r2iH (length=65) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
EPGLVTPLGTLLRPLNSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIY
NSSLILDDVSMSWET
3D structure
PDB8r2i Structure of native photosystem II assembly intermediate from Chlamydomonas reinhardtii
ChainH
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA H F60 I63 F42 I45
BS02 CLA H F57 F60 Y68 F39 F42 Y50
BS03 CLA H F57 L61 F39 L43
BS04 CLA H T46 M50 F53 T28 M32 F35
BS05 CLA H T24 L26 T6 L8
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r2i, PDBe:8r2i, PDBj:8r2i
PDBsum8r2i
PubMed38322422
UniProtP22666|PSBH_CHLRE Photosystem II reaction center protein H (Gene Name=psbH)

[Back to BioLiP]