Structure of PDB 8q5i Chain H

Receptor sequence

>8q5iH (length=226) Species: 5476 (Candida albicans) [Search protein sequence]

MKLNISYPANGTQKSIDIDDEHKLRVFYEKRMGQEVEGDSVGDEFKGYIF
KITGGNDKQGFPMKQGVMHPTRVRLLLSKGHSCYRPRRTGERKRKSVRGC
IVAQDLSVLALSIVKQGDNEIEGLTDTTVPKRLGPKRANHIRKFFGLTKE
DDVRDFVVRREVTKGDKTYTKAPKIQRLVTPQTLQRKRALKAKKVKNAQQ
QRDAAAEYAQLLAKRLHERKEERAEI

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	K2 N4 S6 P8 Q13 S15 R31 T53 N56 K58 Q59 G60 F61 P62 Q65 G66 M68 R72 R74 H81 C83 Y84 R85 R87 R88 T89 G90 R92 R94 K95 S96 S107 A110 K131 R132 L133 G134 P135 K136 R137 N139 H140 K149 R154 R159 R160 K164 K167 Y169 K171 A172 P173 K174 I175 Q176 R177 L178 V179 Q182 T183 L184 Q185 R186 K187 R188 L190 K194 N197 A198 Q201 R202	K2 N4 S6 P8 Q13 S15 R31 T53 N56 K58 Q59 G60 F61 P62 Q65 G66 M68 R72 R74 H81 C83 Y84 R85 R87 R88 T89 G90 R92 R94 K95 S96 S107 A110 K131 R132 L133 G134 P135 K136 R137 N139 H140 K149 R154 R159 R160 K164 K167 Y169 K171 A172 P173 K174 I175 Q176 R177 L178 V179 Q182 T183 L184 Q185 R186 K187 R188 L190 K194 N197 A198 Q201 R202

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	A0A8H6BZ37

[Back to BioLiP]