Structure of PDB 8p2f Chain H

Receptor sequence

>8p2fH (length=216) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

TKGILGRKIGMTQVFGENGELIPVTVVEAKENVVLQKKTVEVDGYNAIQV
GFEDKKAYKKDAKSNKYANKPAEGHAKKADAAPKRFIREFRNVDVDAYEV
GQEVSVDTFVAGDVIDVTGVSKGKGFQGAIKRHGQSRGPMSHGSHFHRAP
GSVGMASDASRVFKGQKMPGRMGGNTVTVQNLEVVQVDTENKVILVKGNV
PGPKKGLVEIRTSIKK

3D structure

• PDB: 8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
• Chain: H
• Resolution: 2.44 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	M12 T13 Q14 P24 Q37 V43 D44 Y46 Q50 S65 N66 K67 Y68 N70 K71 P72 G75 H76 K79 R86 I88 R89 E90 R92 S122 K123 G124 K125 G126 F127 G129 K132 R133 Q136 S137 R138 P140 M141 S142 H143 G144 H146 F147 H148 R149 P151 G152 S153 V154 G155 M156 A157 S158 D159 A160 S161 R162 V163 F164 K165 Q167 M169 P170 R172 T177 T179 Q181 N182 L183 N200 V201 P202 G203 P204 K216	M11 T12 Q13 P23 Q36 V42 D43 Y45 Q49 S64 N65 K66 Y67 N69 K70 P71 G74 H75 K78 R85 I87 R88 E89 R91 S121 K122 G123 K124 G125 F126 G128 K131 R132 Q135 S136 R137 P139 M140 S141 H142 G143 H145 F146 H147 R148 P150 G151 S152 V153 G154 M155 A156 S157 D158 A159 S160 R161 V162 F163 K164 Q166 M168 P169 R171 T176 T178 Q180 N181 L182 N199 V200 P201 G202 P203 K215

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
• PDBsum: 8p2f
• PubMed: 38902339
• UniProt: Q2FW06|RL3_STAA8 Large ribosomal subunit protein uL3 (Gene Name=rplC)