Structure of PDB 8ovj Chain H

Receptor sequence

>8ovjH (length=220) Species: 347515 (Leishmania major strain Friedlin)

FPSRKDAFRAQRKGAKKHRPEIIVIDLKDHVLGRAAAVVAKQLLLGKKIT
VVRCEQLNIAGTEIRNKIKYLQYLRKRKLTNPTKGPFHHRAPSDVFVRTV
RSMLPRYTKRGMKALNSLVAYEGIPPNVVRTGGRVVIPRAQRHVCYRSER
PYTVLGNMCKHVGWKYSDVVANLEKARVEKASRHHEKQAKLRDAWKSARK
EALAKMPKHNVEVLKKFGYA

3D structure

• PDB: 8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Chain: H
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	G35 R36 K43 L46 I66 I70 K71 Q74 R77 K78 R79 K80 L81 S104 M105 K111 R141 Y148 R152	G33 R34 K41 L44 I64 I68 K69 Q72 R75 K76 R77 K78 L79 S102 M103 K109 R139 Y146 R150
BS02	rna	H	P4 S5 R6 F10 R79 H90 R92 K167 Y168	P2 S3 R4 F8 R77 H88 R90 K165 Y166
BS03	rna	H	R11 R14 K30 R55 V131 G134 G135 R136 R179 H187 W197 R201 H211 G220	R9 R12 K28 R53 V129 G132 G133 R134 R177 H185 W195 R199 H209 G218
BS04	rna	H	R11 H20 I24 K50 N83 K86 P88 F89 R108 Y109 S119 Y123 E124 N129 R132 K182 R185 H186	R9 H18 I22 K48 N81 K84 P86 F87 R106 Y107 S117 Y121 E122 N127 R130 K180 R183 H184

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
• PDBsum: 8ovj
• PubMed: 38722744
• UniProt: Q4QFG2