Structure of PDB 8ihm Chain H |
>8ihmH (length=89) Species: 8355 (Xenopus laevis) [Search protein sequence] |
SYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNK RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA |
|
PDB | 8ihm Structural basis for nucleosome binding and catalysis by the yeast Rpd3S/HDAC holoenzyme. |
Chain | H |
Resolution | 3.58 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
H |
I51 S53 R83 S84 |
I19 S21 R51 S52 |
|
|
|
|