Structure of PDB 8g6s Chain H |
>8g6sH (length=93) Species: 8355 (Xenopus laevis) [Search protein sequence] |
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA |
|
PDB | 8g6s Ubiquitinated H2B as gatekeeper of the nucleosome acidic patch |
Chain | H |
Resolution | 3.47 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
H |
S52 R83 S84 T85 |
S24 R55 S56 T57 |
|
|
|
|