Structure of PDB 8eqm Chain H

Receptor sequence
>8eqmH (length=65) Species: 91464 (Synechococcus sp. PCC 7335) [Search protein sequence]
RQKYVSNKAAPLQYPLRKLNSEAGKVVPGWGTAPLMGIMLIALLLFILTI
LQLYNGTVIVEGIDV
3D structure
PDB8eqm Structure of a dimeric photosystem II complex from a cyanobacterium acclimated to far-red light.
ChainH
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA H F47 I51 L52 Y55 F46 I50 L51 Y54
BS02 CLA H T33 A34 M37 M40 T32 A33 M36 M39
BS03 CLA H L20 N21 L19 N20
BS04 CLA H A11 P12 L13 Q14 A10 P11 L12 Q13
BS05 RRX H M37 M40 L41 L44 F47 M36 M39 L40 L43 F46
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eqm, PDBe:8eqm, PDBj:8eqm
PDBsum8eqm
PubMed36549647
UniProtB4WKI0

[Back to BioLiP]