Structure of PDB 8ebv Chain H

Receptor sequence

>8ebvH (length=504) Species: 9606 (Homo sapiens) [Search protein sequence]

IETPEQAKTRERSEKIKLEFETYLRRAMKRFNKGVHEDTHKVHLLCLLAN
GFYRNNICSQPDLHAIGLSIIPARFTRVLPRDVDTYYLSNLVKWFIGTFT
VNAELSASEQDNLQTTLERRFAIYSARDDEELVHIFLLILRALQLLTRLV
LSLQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDG
WVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQ
AKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVY
SRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLRE
ENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNL
PNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWE
NEQAVIERKEKEKKEKRALGNWKLLAKGLLIRERLKRRYGARILAASWPQ
NRED

3D structure

PDB

8ebv Lesion recognition by XPC, TFIIH and XPA in DNA excision repair.

Chain

Resolution

7.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	H	E185 K655 F710 R715 H780 R784 H800 H805	E19 K279 F334 R339 H404 R408 H424 H429
BS02	dna	H	R192 R196 I638 Y656 R671 H685 S686 T689 K692 G709 F710 S711 N712 F756 F762 R781 I794 F797 F799 S804 H805 P806	R26 R30 I262 Y280 R295 H309 S310 T313 K316 G333 F334 S335 N336 F380 F386 R405 I418 F421 F423 S428 H429 P430

Gene Ontology

	Molecular Function
GO:0000404	heteroduplex DNA loop binding
GO:0000405	bubble DNA binding
GO:0003677	DNA binding
GO:0003684	damaged DNA binding
GO:0003697	single-stranded DNA binding
GO:0003713	transcription coactivator activity
GO:0005515	protein binding
GO:0044877	protein-containing complex binding
GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140612	DNA damage sensor activity

	Biological Process
GO:0000720	pyrimidine dimer repair by nucleotide-excision repair
GO:0006281	DNA repair
GO:0006289	nucleotide-excision repair
GO:0006298	mismatch repair
GO:0006974	DNA damage response
GO:0009410	response to xenobiotic stimulus
GO:0010224	response to UV-B
GO:0010996	response to auditory stimulus
GO:0031573	mitotic intra-S DNA damage checkpoint signaling
GO:0045893	positive regulation of DNA-templated transcription
GO:0070914	UV-damage excision repair
GO:1901990	regulation of mitotic cell cycle phase transition

	Cellular Component
GO:0000109	nucleotide-excision repair complex
GO:0000111	nucleotide-excision repair factor 2 complex
GO:0000785	chromatin
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0043231	intracellular membrane-bounded organelle
GO:0071942	XPC complex
GO:0090734	site of DNA damage

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ebv, PDBe:8ebv, PDBj:8ebv
PDBsum	8ebv
PubMed	37076618
UniProt	Q01831\|XPC_HUMAN DNA repair protein complementing XP-C cells (Gene Name=XPC)

[Back to BioLiP]