Structure of PDB 8e7s Chain H

Receptor sequence
>8e7sH (length=93) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRR
FKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
3D structure
PDB8e7s Structural insights into cardiolipin replacement by phosphatidylglycerol in a cardiolipin-lacking yeast respiratory supercomplex.
ChainH
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CDL H I40 A44 I39 A43
Gene Ontology
Molecular Function
GO:0008121 ubiquinol-cytochrome-c reductase activity
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0009060 aerobic respiration
GO:0045333 cellular respiration
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045275 respiratory chain complex III

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8e7s, PDBe:8e7s, PDBj:8e7s
PDBsum8e7s
PubMed37188665
UniProtP08525|QCR8_YEAST Cytochrome b-c1 complex subunit 8, mitochondrial (Gene Name=QCR8)

[Back to BioLiP]