Structure of PDB 8dy7 Chain H

Receptor sequence

>8dy7H (length=85) Species: 54571 (Streptomyces venezuelae) [Search protein sequence]

MTELFQELLVEDADEELGWQERALCAQTDPESFFPEKGGSTREAKKVCLA
CEVRSECLEYALQNDERFGIWGGLSERERRRLKKK

3D structure

PDB

8dy7 Structural basis of dual activation of cell division by the actinobacterial transcription factors WhiA and WhiB.

Chain

Resolution

3.18 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	H	K37 G38 R42	K37 G38 R42
BS02	SF4	H	C25 C48 C51 C57 G72	C25 C48 C51 C57 G72

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0035731	dinitrosyl-iron complex binding
GO:0046872	metal ion binding
GO:0047134	protein-disulfide reductase (NAD(P)H) activity
GO:0051539	4 iron, 4 sulfur cluster binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045454	cell redox homeostasis
GO:0045892	negative regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

External links