Structure of PDB 8cef Chain H

Receptor sequence
>8cefH (length=87) Species: 10090 (Mus musculus) [Search protein sequence]
PKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEIT
KRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKY
3D structure
PDB8cef Asymmetric dimerization in a transcription factor superfamily is promoted by allosteric interactions with DNA.
ChainH
Resolution2.486 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H Y89 H90 Y91 K100 K104 V149 R150 R153 R155 R158 Y161 Y15 H16 Y17 K26 K30 V75 R76 R79 R81 R84 Y87
BS02 dna H A98 F102 R105 K129 Q132 R135 R155 G156 G157 R158 A24 F28 R31 K55 Q58 R61 R81 G82 G83 R84
BS03 ZN H C79 C82 C99 C5 C8 C25
BS04 ZN H C115 C121 C131 C134 C41 C47 C57 C60
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8cef, PDBe:8cef, PDBj:8cef
PDBsum8cef
PubMed37503845
UniProtO08580|ERR1_MOUSE Steroid hormone receptor ERR1 (Gene Name=Esrra)

[Back to BioLiP]