Structure of PDB 8cdl Chain H

Receptor sequence
>8cdlH (length=129) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMV
MATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGE
MKGSAITGPVGKECADLWPRVASNSGVVV
3D structure
PDB8cdl mRNA reading frame maintenance during eukaryotic ribosome translocation
ChainH
Resolution2.72 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna H T9 K10 F11 R12 S14 G16 P18 A21 I22 I37 K40 G41 S44 R45 L46 N47 R48 L49 T61 K63 K71 V73 K83 F92 N98 T1 K2 F3 R4 S6 G8 P10 A13 I14 I29 K32 G33 S36 R37 L38 N39 R40 L41 T53 K55 K63 V65 K75 F84 N90
BS02 rna H R32 R128 R24 R120
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8cdl, PDBe:8cdl, PDBj:8cdl
PDBsum8cdl
PubMed38030725
UniProtP0CX41|RL23A_YEAST Large ribosomal subunit protein uL14A (Gene Name=RPL23A)

[Back to BioLiP]