Structure of PDB 8c3a Chain H

Receptor sequence

>8c3aH (length=206) Species: 5476 (Candida albicans)

LQVVELATTIPLDVQEAQREVKLFNKWSFEDVEVKDVSLVDYIQIRNPVF
VSHTAGKYASKRFRKAQCPIVERLTNSLMMNGRNNGKKLKAVRIVKHALE
IIHVLTEQNPIQVVVDAIVNSGAREDSTRIGSSGTVRRQAVDVSPLRRVN
QAIALLTIGAREASFRNIKTIAECLAEELINAAKGSSTSYAIKKKDELER
VAKSNR

3D structure

• PDB: 8c3a New crystal system to promote screening for new eukaryotic inhibitors
• Chain: H
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	H72 A78 K80 R81 K84 R92 N95 L97 M98 N100 G101 R102 N103 N104 G105 K106 K107 K109 S152 R166 N169 R180 S183 F184 R185 I187 T189 I190	H53 A59 K61 R62 K65 R73 N76 L78 M79 N81 G82 R83 N84 N85 G86 K87 K88 K90 S133 R147 N150 R161 S164 F165 R166 I168 T170 I171
BS02	MG	H	S183 K188	S164 K169

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
• PDBsum: 8c3a
• UniProt: A0A8H6BS29