Structure of PDB 8axk Chain H |
>8axkH (length=75) Species: 623 (Shigella flexneri) [Search protein sequence] |
MSDIVYMGNKALYLILIFSLWPVGIATVIGLSIGLLLPFGIKLIGVSISL LLLSGWYGEVLLSFCHEIMFLIKSG |
|
PDB | 8axk Integrative structural analysis of the type III secretion system needle complex from Shigella flexneri. |
Chain | H |
Resolution | 4.05 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
H |
Y6 Y13 |
Y6 Y13 |
|
|
|
|