Structure of PDB 8ap9 Chain H

Receptor sequence

>8ap9H (length=161) Species: 5702 (Trypanosoma brucei brucei)

HDLPEGFEFMEHKVVNKDIHAPHENLETLRLTLTRQDEFLLREEPVKCVT
VTGTNGEYGIYPGHAYKIVQLNPSPLTVEYTDGTTKKYFVSGGFAHINNE
GSCDVNTVECTLLDDLDLAIAEKELAAQQAALGSAKDDKAKSVVEIRISV
IEAVIAALKHH

3D structure

• PDB: 8ap9 An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
• Chain: H
• Resolution: 3.7 Å

Enzymatic activity

• Enzyme Commision number: 3.6.3.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UTP	H	N76 Y79 K88	N55 Y58 K67

Gene Ontology

Molecular Function

• GO:0016787 hydrolase activity
• GO:0046933 proton-transporting ATP synthase activity, rotational mechanism

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0015986 proton motive force-driven ATP synthesis

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

External links

• PDB: RCSB:8ap9, PDBe:8ap9, PDBj:8ap9
• PDBsum: 8ap9
• PubMed: 36220811
• UniProt: Q586H1