Structure of PDB 7zai Chain H

Receptor sequence

>7zaiH (length=214) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]

AKPLSERFFIPHEIKVMGRWSTEDVEVRDPSLKPYINLEPRLLPHTHGRH
AKKHFGKANVHIVERLINKIMRSGGSHYKVAGHFMRREHRSLNSKKVKAY
EVVKEAFKIIEKRTGKNPIQVLVWAIENAAPREDTTSVMFGGIRYHVAVD
ISPMRRLDVALRNIALGASAKCYRTKMSFAEALAEEIILAANKDPKSYAY
SKKLEIERIAESSR

3D structure

PDB

7zai Role of aIF5B in archaeal translation initiation.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	K3 H48 H55 K58 R66 N69 K70 R73 S74 S77 H78 Y79 K80 H84 F85 R87 R88 E89 R91 S92 L93 N94 S95 K96 D159 R163 S170 Y174 R175 T176 K177 S179 F180	K2 H47 H54 K57 R65 N68 K69 R72 S73 S76 H77 Y78 K79 H83 F84 R86 R87 E88 R90 S91 L92 N93 S94 K95 D158 R162 S169 Y173 R174 T175 K176 S178 F179
BS02	rna	H	F141 G142 G143	F140 G141 G142

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zai, PDBe:7zai, PDBj:7zai
PDBsum	7zai
PubMed	35694843
UniProt	Q9V109\|RS7_PYRAB Small ribosomal subunit protein uS7 (Gene Name=rps7)

[Back to BioLiP]