Structure of PDB 7vox Chain H

Receptor sequence
>7voxH (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
HAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNS
IRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGN
3D structure
PDB7vox FOXL2 and FOXA1 cooperatively assemble on the TP53 promoter in alternative dimer configurations.
ChainH
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H S174 Y175 R213 N216 S217 H220 K240 S7 Y8 R46 N49 S50 H53 K73
BS02 dna H L193 R219 H220 S223 K230 K240 G241 S242 W244 L26 R52 H53 S56 K63 K73 G74 S75 W77
BS03 MG H Y173 S174 S177 Y6 S7 S10
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7vox, PDBe:7vox, PDBj:7vox
PDBsum7vox
PubMed35920317
UniProtP55317|FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha (Gene Name=FOXA1)

[Back to BioLiP]