Structure of PDB 7v2o Chain H

Receptor sequence
>7v2oH (length=138) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYER
VDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEI
PRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
3D structure
PDB7v2o Decoding the Mechanism of Specific RNA Targeting by Ribosomal Methyltransferases.
ChainH
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H M1 T3 D8 T11 R12 R14 N15 R18 K21 S29 R30 F31 K56 R75 K88 P89 R91 R92 Y94 G96 V97 R105 S113 T114 S115 G128 V129 G130 E132 M1 T3 D8 T11 R12 R14 N15 R18 K21 S29 R30 F31 K56 R75 K88 P89 R91 R92 Y94 G96 V97 R105 S113 T114 S115 G128 V129 G130 E132
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7v2o, PDBe:7v2o, PDBj:7v2o
PDBsum7v2o
PubMed35316014
UniProtP0DOY9|RS8_THET8 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]