Structure of PDB 7upg Chain H |
>7upgH (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] |
SVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKI GSLDNITHVPGGGNKKIETHKLTFR |
|
PDB | 7upg Structure-based discovery of small molecules that disaggregate Alzheimer's disease tissue derived tau fibrils in vitro. |
Chain | H |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
KDH |
H |
E338 K340 |
E34 K36 |
|
|
|
|