Structure of PDB 7u5e Chain H

Receptor sequence
>7u5eH (length=202) Species: 645 (Aeromonas salmonicida) [Search protein sequence]
NRYFFAIRYLSDDVDCGLLAGRCISILHGFRQAHPGIQIGVAFPEWSDRD
LGRSIAFVSTNKSLLERFRERSYFQVMQADNFFALSLVLEVPDTCQNVRF
IRNQNLAKLFVGERRRRLARAKRRAKARGEAFQPHMPDETKVVGVFHSVF
MQSASSGQSYILHIQKHRYERSEDSGYSSYGLASNDLYTGYVPDLGAIFS
TL
3D structure
PDB7u5e Multiple adaptations underly co-option of a CRISPR surveillance complex for RNA-guided DNA transposition.
ChainH
Resolution4.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H Q107 K111 F113 G115 R119 L121 R123 R127 R131 M139 P140 F153 A157 Y163 H166 S187 D189 Q104 K108 F110 G112 R116 L118 R120 R124 R128 M136 P137 F150 A154 Y160 H163 S184 D186
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 17 03:28:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7u5e', asym_id = 'H', title = 'Multiple adaptations underly co-option of a CRIS...illance complex for RNA-guided DNA transposition.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7u5e', asym_id='H', title='Multiple adaptations underly co-option of a CRIS...illance complex for RNA-guided DNA transposition.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004519,0043571', uniprot = '', pdbid = '7u5e', asym_id = 'H'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519,0043571', uniprot='', pdbid='7u5e', asym_id='H')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>