Structure of PDB 7tao Chain H

Receptor sequence
>7taoH (length=159) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MTELCPVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLL
FKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLS
GLAAGFAIGIVGDAGVRGSSQQPRLFVGMILILIFAEVLGLYGLIVALLL
NSRATQDVV
3D structure
PDB7tao Cryo-EM of the Yeast V O Complex Reveals Distinct Binding Sites for Macrolide V-ATPase Inhibitors.
ChainH
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 WEV H F51 I58 I65 F51 I58 I65
BS02 WEV H F135 Y142 F135 Y142
Gene Ontology
Molecular Function
GO:0015078 proton transmembrane transporter activity
GO:0046961 proton-transporting ATPase activity, rotational mechanism
Biological Process
GO:0006623 protein targeting to vacuole
GO:0006878 intracellular copper ion homeostasis
GO:0006879 intracellular iron ion homeostasis
GO:0006897 endocytosis
GO:0007033 vacuole organization
GO:0007035 vacuolar acidification
GO:0048388 endosomal lumen acidification
GO:0061795 Golgi lumen acidification
GO:1902600 proton transmembrane transport
Cellular Component
GO:0000139 Golgi membrane
GO:0000220 vacuolar proton-transporting V-type ATPase, V0 domain
GO:0000329 fungal-type vacuole membrane
GO:0005773 vacuole
GO:0005774 vacuolar membrane
GO:0016020 membrane
GO:0016471 vacuolar proton-transporting V-type ATPase complex
GO:0033176 proton-transporting V-type ATPase complex
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0033179 proton-transporting V-type ATPase, V0 domain

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7tao, PDBe:7tao, PDBj:7tao
PDBsum7tao
PubMed35148071
UniProtP25515|VATL1_YEAST V-type proton ATPase subunit c (Gene Name=VMA3)

[Back to BioLiP]